Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS2 Rabbit Polyclonal Antibody (Biotin)

BCAS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DAM1, SPF27, Snt309

UniProt

O75934

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BCAS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005863

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX9 (Paired Box Protein Pax-9) (APC)
130912-APC 100 µL

PAX9 (Paired Box Protein Pax-9) (APC)

Sign In for Pricing
View Details
Factor VII Antibody HRP Conjugated
orb1542175 100 µL

Factor VII Antibody HRP Conjugated

Sign In for Pricing
View Details
Emcn 3'UTR GFP Stable Cell Line
TU253951 1.0 mL

Emcn 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TBXAS1 Antibody
orb1324609 100 µL

TBXAS1 Antibody

Sign In for Pricing
View Details
GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 650)
127319-ML650 100 µL

GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 650)

Sign In for Pricing
View Details
PRKD1 Antibody
orb686520-01 50 μL

PRKD1 Antibody

Sign In for Pricing
View Details