Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS2 Rabbit Polyclonal Antibody (FITC)

BCAS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DAM1, SPF27, Snt309

UniProt

O75934

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BCAS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005863

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 750)
MBS6277171-01 0.1 mL

B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 750)

Sign In for Pricing
View Details
B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 750)
MBS6277171-02 5x 0.1 mL

B3GNT6, ID (B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6, Core 3 synthase) (MaxLight 750)

Sign In for Pricing
View Details
Aprotinin monoclonal antibody (21)
BPD-ABS-037-21-04 400 µg

Aprotinin monoclonal antibody (21)

Sign In for Pricing
View Details
Probable alpha-galactosidase B (Biotin)
307013-01 50 µg

Probable alpha-galactosidase B (Biotin)

Sign In for Pricing
View Details
Probable alpha-galactosidase B (Biotin)
307013-02 100 µg

Probable alpha-galactosidase B (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Rpp40 shRNA (UAS) - Lentiviral mouse Rpp40 shRNA (UAS, GFP) plasmid
GTR15229390 1 Vial

Lentiviral mouse Rpp40 shRNA (UAS) - Lentiviral mouse Rpp40 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details