Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A1 Rabbit Polyclonal Antibody (Biotin)

SF3A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRP21, PRPF21, SAP114, SF3A120

UniProt

Q15459

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYEF2 (Myelin Expression Factor 2, MEF-2, MST156, MSTP156, HsT18564) (MaxLight 650)
MBS6427912-01 0.1 mL

MYEF2 (Myelin Expression Factor 2, MEF-2, MST156, MSTP156, HsT18564) (MaxLight 650)

Sign In for Pricing
View Details
MYEF2 (Myelin Expression Factor 2, MEF-2, MST156, MSTP156, HsT18564) (MaxLight 650)
MBS6427912-02 5x 0.1 mL

MYEF2 (Myelin Expression Factor 2, MEF-2, MST156, MSTP156, HsT18564) (MaxLight 650)

Sign In for Pricing
View Details
MIR6386 Mouse MicroRNA Expression Plasmid (MI0021918)
SC402718 10 µg

MIR6386 Mouse MicroRNA Expression Plasmid (MI0021918)

Sign In for Pricing
View Details
Recombinant Human IKK beta (N-GST tag)
Z500177 10 µg

Recombinant Human IKK beta (N-GST tag)

Sign In for Pricing
View Details
Human PDHB Protein
orb1478037-01 20 µg

Human PDHB Protein

Sign In for Pricing
View Details
Human PDHB Protein
orb1478037-02 100 µg

Human PDHB Protein

Sign In for Pricing
View Details