Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A1 Rabbit Polyclonal Antibody (FITC)

SF3A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRP21, PRPF21, SAP114, SF3A120

UniProt

Q15459

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (MaxLight 650)
MBS6439264-01 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (MaxLight 650)

Sign In for Pricing
View Details
STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (MaxLight 650)
MBS6439264-02 5x 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (MaxLight 650)

Sign In for Pricing
View Details
Nicotelline
N2561-30 5 mg

Nicotelline

Sign In for Pricing
View Details
Recombinant Rat IL-17E Protein
8949-IL-025 25 µg

Recombinant Rat IL-17E Protein

Sign In for Pricing
View Details
GAGE2B, NT (GAGE2B, GAGE2, G antigen 2B/2C, Cancer/testis antigen 4.2, G antigen 2C) (MaxLight 550)
MBS6301023-01 0.1 mL

GAGE2B, NT (GAGE2B, GAGE2, G antigen 2B/2C, Cancer/testis antigen 4.2, G antigen 2C) (MaxLight 550)

Sign In for Pricing
View Details
GAGE2B, NT (GAGE2B, GAGE2, G antigen 2B/2C, Cancer/testis antigen 4.2, G antigen 2C) (MaxLight 550)
MBS6301023-02 5x 0.1 mL

GAGE2B, NT (GAGE2B, GAGE2, G antigen 2B/2C, Cancer/testis antigen 4.2, G antigen 2C) (MaxLight 550)

Sign In for Pricing
View Details