Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3A1 Rabbit Polyclonal Antibody (HRP)

SF3A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRP21, PRPF21, SAP114, SF3A120

UniProt

Q15459

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Two pore calcium channel protein 2 (TPCN2) Human Gene Knockout Kit (CRISPR)
KN209023BN 1 Kit

Two pore calcium channel protein 2 (TPCN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH3GLB2 (NM_001287046) Human Tagged ORF Clone
RG237950 10 µg

SH3GLB2 (NM_001287046) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (D405V, Q414A) (His Tag)
PKSV030419 100 µg

Recombinant SARS-CoV-2 Spike RBD (D405V, Q414A) (His Tag)

Sign In for Pricing
View Details
SH3PX1 (SNX9) Human Gene Knockout Kit (CRISPR)
KN402822 1 Kit

SH3PX1 (SNX9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCC (NM_002387) Human Over-expression Lysate
LY419354 100 µg

MCC (NM_002387) Human Over-expression Lysate

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF405S conjugate, 0.1mg/mL
BNC041796-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details