Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIE Rabbit Polyclonal Antibody (Biotin)

PPIE Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CYP33, CYP-33

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_982282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TEKT4 activation kit by CRISPRa
GA115756 1 Kit

Human TEKT4 activation kit by CRISPRa

Sign In for Pricing
View Details
PRMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
TA503588AM 100 µL

PRMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF740 conjugate, 0.1mg/mL
BNC741147-100 1x 100 µL

CD45RB (PTPRC/1147), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ADAM22 Antibody
RN-052-01 50 μL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details
Recombinant ADAM22 Antibody
RN-052-02 100 µL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details
Recombinant ADAM22 Antibody
RN-052-03 1 mL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details