Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIE Rabbit Polyclonal Antibody (FITC)

PPIE Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYP33, CYP-33

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_982282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STEEP1 (NM_001170569) Human Over-expression Lysate
LY432632 100 µg

STEEP1 (NM_001170569) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl-D5-Amine Hydrochloride
TRC-E898292-1G 1 g

Ethyl-D5-Amine Hydrochloride

Sign In for Pricing
View Details
Tnni2 (NM_009405) Mouse Tagged ORF Clone
MG201648 10 µg

Tnni2 (NM_009405) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ITGA1 Antibody
KC-24958-01 50 μL

ITGA1 Antibody

Sign In for Pricing
View Details
ITGA1 Antibody
KC-24958-02 100 µL

ITGA1 Antibody

Sign In for Pricing
View Details
ITGA1 Antibody
KC-24958-03 1 mL

ITGA1 Antibody

Sign In for Pricing
View Details