Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIE Rabbit Polyclonal Antibody (FITC)

PPIE Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYP33, CYP-33

UniProt

Q9UNP9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_006103

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATOX1 (ATX1 Antioxidant Protein 1 Homolog (yeast), ATX1, HAH1, MGC138453, MGC138455) (MaxLight 490)
MBS6205268-01 0.1 mL

ATOX1 (ATX1 Antioxidant Protein 1 Homolog (yeast), ATX1, HAH1, MGC138453, MGC138455) (MaxLight 490)

Sign In for Pricing
View Details
ATOX1 (ATX1 Antioxidant Protein 1 Homolog (yeast), ATX1, HAH1, MGC138453, MGC138455) (MaxLight 490)
MBS6205268-02 5x 0.1 mL

ATOX1 (ATX1 Antioxidant Protein 1 Homolog (yeast), ATX1, HAH1, MGC138453, MGC138455) (MaxLight 490)

Sign In for Pricing
View Details
JC-1 100mg
A15135-100 100 mg

JC-1 100mg

Sign In for Pricing
View Details
Chx10 (D-11) Alexa Fluor® 647
sc-374151 AF647 200 µg/mL

Chx10 (D-11) Alexa Fluor® 647

Sign In for Pricing
View Details
SH3BP4 Antibody - N-terminal region
ARP55075_P050-25UL 25 µL

SH3BP4 Antibody - N-terminal region

Sign In for Pricing
View Details
Zinc Finger Protein 774 (ZNF774) Antibody (HRP)
abx306267-01 20 µg

Zinc Finger Protein 774 (ZNF774) Antibody (HRP)

Sign In for Pricing
View Details