Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIE Rabbit Polyclonal Antibody (HRP)

PPIE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYP33, CYP-33

UniProt

Q9UNP9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_006103

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KPNA2 Antibody Picoband® Fluoro550 Conjugated
A01776-1-Fluoro550 100 µg/Vial

Anti-KPNA2 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
CDK5 (Cyclin-Dependent Kinase 5, Cell Division Protein Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit)
124788 100 µg

CDK5 (Cyclin-Dependent Kinase 5, Cell Division Protein Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit)

Sign In for Pricing
View Details
RNU5F-4P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV746335 1.0 µg DNA

RNU5F-4P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Mrpl18 qPCR Primer Pair
QM34730S 200 Tests

Mouse Mrpl18 qPCR Primer Pair

Sign In for Pricing
View Details
Forceps Listons 7.5inch Bone Cutting
INS4260 1 Each

Forceps Listons 7.5inch Bone Cutting

Sign In for Pricing
View Details
SLC26A8 (NM_052961) Human Tagged Lenti ORF Clone
RC221535L3 10 µg

SLC26A8 (NM_052961) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details