Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAIP1 Rabbit Polyclonal Antibody (HRP)

PAIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H074

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PAIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_877590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL22 Mouse mAb
63834 100 µL

KLHL22 Mouse mAb

Sign In for Pricing
View Details
Isopropanol-1,1,1,2,3,3,3-D7 >99 Atom % D 1ml ampoule
DE280 1 Each

Isopropanol-1,1,1,2,3,3,3-D7 >99 Atom % D 1ml ampoule

Sign In for Pricing
View Details
Rat Monoclonal GITR/TNFRSF18 Antibody (108619) [Janelia Fluor 549]
FAB5241I 0.5 mL

Rat Monoclonal GITR/TNFRSF18 Antibody (108619) [Janelia Fluor 549]

Sign In for Pricing
View Details
SDR39U1 Recombinant Protein (Mouse)
RP170477 100 µg

SDR39U1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (S139) (Histone H2AX, H2a/x, Histone H2A.X, H2AFX, H2AX, y-H2AX, yH2AX, ganunaH2AX, y-H2A.X, yH2A.X, ganunaH2A.X) discontinued
223241-01 50 µL

Histone H2A.X, phosphorylated (S139) (Histone H2AX, H2a/x, Histone H2A.X, H2AFX, H2AX, y-H2AX, yH2AX, ganunaH2AX, y-H2A.X, yH2A.X, ganunaH2A.X) discontinued

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (S139) (Histone H2AX, H2a/x, Histone H2A.X, H2AFX, H2AX, y-H2AX, yH2AX, ganunaH2AX, y-H2A.X, yH2A.X, ganunaH2A.X) discontinued
223241-02 100 µL

Histone H2A.X, phosphorylated (S139) (Histone H2AX, H2a/x, Histone H2A.X, H2AFX, H2AX, y-H2AX, yH2AX, ganunaH2AX, y-H2A.X, yH2A.X, ganunaH2A.X) discontinued

Sign In for Pricing
View Details