Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS3 Rabbit Polyclonal Antibody (FITC)

KHDRBS3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Etle, SALP, SLM2, SLM-2, TSTAR, T-STAR, etoile

UniProt

O75525

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KHDRBS3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF1, ID (SF1, ZFM1, ZNF162, Splicing factor 1, Mammalian branch point-binding protein, Transcription factor ZFM1, Zinc finger gene in MEN1 locus, Zinc finger protein 162) (MaxLight 490) discontinued
041609-ML490 100 µL

SF1, ID (SF1, ZFM1, ZNF162, Splicing factor 1, Mammalian branch point-binding protein, Transcription factor ZFM1, Zinc finger gene in MEN1 locus, Zinc finger protein 162) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG (H+L) Secondary Antibody, Unconjugated
BA1040-1mg 1 mg

Rabbit Anti-Goat IgG (H+L) Secondary Antibody, Unconjugated

Sign In for Pricing
View Details
Magnesium gluconate dihydrate 98%
M00350-01 500 g

Magnesium gluconate dihydrate 98%

Sign In for Pricing
View Details
Magnesium gluconate dihydrate 98%
M00350-02 1000 g

Magnesium gluconate dihydrate 98%

Sign In for Pricing
View Details
Magnesium gluconate dihydrate 98%
M00350-03 5000 g

Magnesium gluconate dihydrate 98%

Sign In for Pricing
View Details
C16orf87 3'UTR Luciferase Stable Cell Line
TU003019 1.0 mL

C16orf87 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details