Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT1 Rabbit Polyclonal Antibody (HRP)

ADAT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HADAT1

UniProt

Q9BUB4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADAT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Protein RBD (Omicron BA.2.75 Variant) Protein
abx620761-01 100 µg

SARS-CoV-2 Spike Protein RBD (Omicron BA.2.75 Variant) Protein

Sign In for Pricing
View Details
SARS-CoV-2 Spike Protein RBD (Omicron BA.2.75 Variant) Protein
abx620761-02 1 mg

SARS-CoV-2 Spike Protein RBD (Omicron BA.2.75 Variant) Protein

Sign In for Pricing
View Details
KIST, NT (UHMK1, KIS, KIST, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (MaxLight 750)
MBS6313477-01 0.1 mL

KIST, NT (UHMK1, KIS, KIST, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (MaxLight 750)

Sign In for Pricing
View Details
KIST, NT (UHMK1, KIS, KIST, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (MaxLight 750)
MBS6313477-02 5x 0.1 mL

KIST, NT (UHMK1, KIS, KIST, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (MaxLight 750)

Sign In for Pricing
View Details
EZHIP (D-1) : m-IgG2b BP-HRP Bundle
sc-548816 1 Kit

EZHIP (D-1) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
Phaseolus vulgaris (PHA-L) (Cy3)
518653 1 mg

Phaseolus vulgaris (PHA-L) (Cy3)

Sign In for Pricing
View Details