Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B3 Rabbit Polyclonal Antibody (HRP)

SF3B3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RSE1, SAP130, SF3b130, STAF130

UniProt

Q15393

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SF3B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

135kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase C beta 3 (PLCB3) Human Knockdown Lysate
LY300508 100 µg

Phospholipase C beta 3 (PLCB3) Human Knockdown Lysate

Sign In for Pricing
View Details
PSMB8 Rabbit Monoclonal Antibody
TA423618 100 µL

PSMB8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS642560 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
STAMBPL1 Human Gene Knockout Kit (CRISPR)
KN201884LP 1 Kit

STAMBPL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ROBO1 Mouse Monoclonal Antibody [10E2]
EM1901-72 100 µL

ROBO1 Mouse Monoclonal Antibody [10E2]

Sign In for Pricing
View Details
2,3,4-Trichlorophenylboronic Acid
TRC-T896245-50MG 50 mg

2,3,4-Trichlorophenylboronic Acid

Sign In for Pricing
View Details