Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B1 Rabbit Polyclonal Antibody (FITC)

SF3B1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155

UniProt

Q7Z497

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

AAH56155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CXADR Antibody (SAA0357)
HX017013-01 50 µg

Anti-Human CXADR Antibody (SAA0357)

Sign In for Pricing
View Details
Anti-Human CXADR Antibody (SAA0357)
HX017013-02 100 µg

Anti-Human CXADR Antibody (SAA0357)

Sign In for Pricing
View Details
Anti-Human CXADR Antibody (SAA0357)
HX017013-03 1 mg

Anti-Human CXADR Antibody (SAA0357)

Sign In for Pricing
View Details
Lentiviral human HIGD2A shRNA (UAS) - Lentiviral human HIGD2A shRNA (UAS, RFP) (25)
GTR15317198 1 Vial

Lentiviral human HIGD2A shRNA (UAS) - Lentiviral human HIGD2A shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (FITC)
MBS6402938-01 0.1 mL

THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (FITC)

Sign In for Pricing
View Details
THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (FITC)
MBS6402938-02 5x 0.1 mL

THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (FITC)

Sign In for Pricing
View Details