Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF6 Rabbit Polyclonal Antibody (FITC)

PRPF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102

UniProt

O94906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-WAVE1 (Tyr125) BioAssayTM ELISA Kit
473522 2x 96 Tests

Phospho-WAVE1 (Tyr125) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Dog Interleukin 1 Beta (IL1b) ELISA Kit
abx257795 96 Well

Dog Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
MCAM CRISPRa sgRNA lentivector (set of three targets)(Rat)
28197126 3x 1.0µg DNA

MCAM CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ZNRF1 antibody - N-terminal region (ARP39690_P050)
ARP39690_P050 100 µL

ZNRF1 antibody - N-terminal region (ARP39690_P050)

Sign In for Pricing
View Details
Notchl (HRP)
570407-01 50 µg

Notchl (HRP)

Sign In for Pricing
View Details
Notchl (HRP)
570407-02 100 µg

Notchl (HRP)

Sign In for Pricing
View Details