Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF6 Rabbit Polyclonal Antibody (FITC)

PRPF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102

UniProt

O94906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV639266 1.0 µg DNA

NKX2-6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
STIM2 Rabbit Polyclonal Antibody (HRP)
orb474171 100 µL

STIM2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MKRNP1 siRNA Oligos set (Human)
62004171 3x 5 nmol

MKRNP1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit ATIC Antibody
orb1523302-01 10 µL

Rabbit ATIC Antibody

Sign In for Pricing
View Details
Rabbit ATIC Antibody
orb1523302-02 100 µL

Rabbit ATIC Antibody

Sign In for Pricing
View Details
CPA4, CT (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3) (PE) discontinued
C1204-11-PE 200 µL

CPA4, CT (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3) (PE) discontinued

Sign In for Pricing
View Details