Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF6 Rabbit Polyclonal Antibody (HRP)

PRPF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102

UniProt

O94906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTPMT1 (NM_175732) AAV Particle
RC215376A1V 250 µL

Human PTPMT1 (NM_175732) AAV Particle

Sign In for Pricing
View Details
ATP5A1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV719257 1.0 µg DNA

ATP5A1P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Compound NP-013404
MBS5794832 Inquire

Compound NP-013404

Sign In for Pricing
View Details
CDKN3 Rabbit Polyclonal Antibody (AP)
orb891580 100 µL

CDKN3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
ANXA9 Antibody, FITC conjugated
A12753-100UG 100 µg

ANXA9 Antibody, FITC conjugated

Sign In for Pricing
View Details
EIF2A (Center) Rabbit pAb
MBS8555509-01 0.1 mL

EIF2A (Center) Rabbit pAb

Sign In for Pricing
View Details