Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF6 Rabbit Polyclonal Antibody (HRP)

PRPF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102

UniProt

O94906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5' Yakima Yellow / 3' ECLIPSE
FP-155-05 5 to 9 nmol

5' Yakima Yellow / 3' ECLIPSE

Sign In for Pricing
View Details
Anti-Engulfment And Cell Motility 2 (ELMO2)
FY-AB52431-01 1 mL

Anti-Engulfment And Cell Motility 2 (ELMO2)

Sign In for Pricing
View Details
Anti-Engulfment And Cell Motility 2 (ELMO2)
FY-AB52431-02 100 µL

Anti-Engulfment And Cell Motility 2 (ELMO2)

Sign In for Pricing
View Details
Anti-Engulfment And Cell Motility 2 (ELMO2)
FY-AB52431-03 200 µL

Anti-Engulfment And Cell Motility 2 (ELMO2)

Sign In for Pricing
View Details
SGI-1776
474186 100 mg

SGI-1776

Sign In for Pricing
View Details
SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (PE)
MBS6346613-01 0.2 mL

SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (PE)

Sign In for Pricing
View Details