Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Rabbit Polyclonal Antibody (HRP)

PPP1R8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARD1, ARD-1, NIPP1, NIPP-1, PRO2047

UniProt

Q12972

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1R8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF647 conjugate, 0.1mg/mL
BNC471481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-903
BCBS-903 1 Unit

Biological Safety Cabinet Class II BCBS-903

Sign In for Pricing
View Details
H5N1 TaqMan Probe/Primer and Control Set
TM35410 100 Reactions

H5N1 TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
TXNRD1 Rabbit Polyclonal Antibody
TA385501 100 µL

TXNRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCA1 Human Gene Knockout Kit (CRISPR)
KN221861RB 1 Kit

ABCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807598 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details