Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRP68 Rabbit Polyclonal Antibody (HRP)

SRP68 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UHB9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SRP68

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055045

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRA-2α Antibody
orb193774-01 50 μL

TRA-2α Antibody

Sign In for Pricing
View Details
TRA-2α Antibody
orb193774-02 100 µL

TRA-2α Antibody

Sign In for Pricing
View Details
MST1R Antibody, FITC conjugated
CSB-PA015056LC01HU-01 50 μL

MST1R Antibody, FITC conjugated

Sign In for Pricing
View Details
MST1R Antibody, FITC conjugated
CSB-PA015056LC01HU-02 100 µL

MST1R Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Matrix Metallopeptidase 7 (Matrilysin, Uterine) (Mmp7) Elisa Kit
EKC37354 96 Tests

Mouse Matrix Metallopeptidase 7 (Matrilysin, Uterine) (Mmp7) Elisa Kit

Sign In for Pricing
View Details
Vom2r11 (NM_001099470) Rat Tagged ORF Clone Lentiviral Particle
RR207656L4V 200 µL

Vom2r11 (NM_001099470) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details