Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM9 Rabbit Polyclonal Antibody (HRP)

RBM9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RTA, fxh, FOX2, RBM9, Fox-2, HNRBP2, HRNBP2, dJ106I20.3

UniProt

O43251

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Human, Mouse, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) BioAssayTM ELISA Kit (Human) discontinued
382573 96 Tests

CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Human HUS1 siRNA
abx920065-01 15 nmol

Human HUS1 siRNA

Sign In for Pricing
View Details
Human HUS1 siRNA
abx920065-02 30 nmol

Human HUS1 siRNA

Sign In for Pricing
View Details
Mouse Monoclonal Serum Response Factor SRF Antibody (PCRP-SRF-1F7) [Alexa Fluor 488]
NBP3-14188AF488 0.1 mL

Mouse Monoclonal Serum Response Factor SRF Antibody (PCRP-SRF-1F7) [Alexa Fluor 488]

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)
MBS2164664-01 0.1 mL

PE-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)
MBS2164664-02 0.2 mL

PE-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)

Sign In for Pricing
View Details