Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAU2 Rabbit Polyclonal Antibody (HRP)

STAU2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

39K2, 39K3

UniProt

Q9NUL3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAU2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CRABP2 Protein (His Tag)
PKSH031210 100 µg

Recombinant Human CRABP2 Protein (His Tag)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF568 conjugate, 0.1mg/mL
BNC682571-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR52 Polyclonal Antibody
E-AB-90396-01 60 µL

GPR52 Polyclonal Antibody

Sign In for Pricing
View Details
GPR52 Polyclonal Antibody
E-AB-90396-02 120 µL

GPR52 Polyclonal Antibody

Sign In for Pricing
View Details
GPR52 Polyclonal Antibody
E-AB-90396-03 200 µL

GPR52 Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-8 (Interleukin 8) CLIA Kit
E-CL-H0048-01 24 Tests

Human IL-8 (Interleukin 8) CLIA Kit

Sign In for Pricing
View Details