Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csdc2 Rabbit Polyclonal Antibody (Biotin)

Csdc2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pippin, AI415250, AI481750

UniProt

Q9DCB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VWPTFPFHREGSRIWERGGGIAPRDLPSPLPTKRTRTYSATARASAGPVF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171094

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W063/NT/PE-TRI100-3 Marine & IMO Signs & Labels (Adhesive)
302209 3 Pack (3 Panel (s) x 1 Pack)

W/W063/NT/PE-TRI100-3 Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Mfsd10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6191105 3x 1.0 µg

Mfsd10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis dnaN Protein (aa 1-397)
VAng-Yyj4650-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Smegmatis dnaN Protein (aa 1-397)

Sign In for Pricing
View Details
HK3 Rabbit Polyclonal Antibody (Cy3)
orb2818242 100 µg

HK3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MTPN antibody - middle region (ARP52859_P050)
ARP52859_P050 100 µL

MTPN antibody - middle region (ARP52859_P050)

Sign In for Pricing
View Details
Mouse Insulin-Like Growth Factor-Binding Protein 2 (IGFBP2) ELISA Development Kit
abx378598-01 5x 96 Tests

Mouse Insulin-Like Growth Factor-Binding Protein 2 (IGFBP2) ELISA Development Kit

Sign In for Pricing
View Details