Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csdc2 Rabbit Polyclonal Antibody (FITC)

Csdc2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pippin, AI415250, AI481750

UniProt

Q9DCB4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VWPTFPFHREGSRIWERGGGIAPRDLPSPLPTKRTRTYSATARASAGPVF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171094

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Premium Pipette, PP, 10uL-100uL - ABDOS
E11103 1 Each

Premium Pipette, PP, 10uL-100uL - ABDOS

Sign In for Pricing
View Details
TMEM154 (NM_152680) Human Tagged Lenti ORF Clone
RC209180L2 10 µg

TMEM154 (NM_152680) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Canine Parvovirus Antibody (8H7) [Janelia Fluor 669]
NB100-73204JF669 0.2 mL

Mouse Monoclonal Canine Parvovirus Antibody (8H7) [Janelia Fluor 669]

Sign In for Pricing
View Details
Hamster Collagen Type VI Alpha 3 ELISA Kit
MBS100697-01 48 Well

Hamster Collagen Type VI Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Collagen Type VI Alpha 3 ELISA Kit
MBS100697-02 96 Well

Hamster Collagen Type VI Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Collagen Type VI Alpha 3 ELISA Kit
MBS100697-03 5x 96 Well

Hamster Collagen Type VI Alpha 3 ELISA Kit

Sign In for Pricing
View Details