Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSDC2 Rabbit Polyclonal Antibody (HRP)

CSDC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIPPIN, dJ347H13.2

UniProt

Q9Y534

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CSDC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Plectin Polyclonal Antibody
OAAI00436-100UG 100 µg

Anti-Plectin Polyclonal Antibody

Sign In for Pricing
View Details
XPNPEP3 Protein Vector (Rat) (pPM-C-His)
PV316853 500 ng

XPNPEP3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Methicillin-resistant Staphylococcus aureus Probe-based qPCR Kit
MK1F727-01 48 Test

Methicillin-resistant Staphylococcus aureus Probe-based qPCR Kit

Sign In for Pricing
View Details
Methicillin-resistant Staphylococcus aureus Probe-based qPCR Kit
MK1F727-02 50 Tests

Methicillin-resistant Staphylococcus aureus Probe-based qPCR Kit

Sign In for Pricing
View Details
Mouse Monoclonal JAZF1 Antibody (PCRP-JAZF1-1C2) [Alexa Fluor 647]
NBP3-14221AF647 0.1 mL

Mouse Monoclonal JAZF1 Antibody (PCRP-JAZF1-1C2) [Alexa Fluor 647]

Sign In for Pricing
View Details
BeyoGoldTM 15ml Centrifuge Tubes
FTUB515 25 PCS/Pack - 20 PKS/Box

BeyoGoldTM 15ml Centrifuge Tubes

Sign In for Pricing
View Details