Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63A Rabbit Polyclonal Antibody (FITC)

TMEM63A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HLD19, KIAA0792

UniProt

O94886

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_055513

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB527515 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
(±)-trans-Chrysanthemic Acid
TRC-C432790-500MG 500 mg

(±)-trans-Chrysanthemic Acid

Sign In for Pricing
View Details
Clasp2 Mouse Gene Knockout Kit (CRISPR)
KN503381 1 Kit

Clasp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF647 conjugate, 0.1mg/mL
BNC471126-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF740 conjugate, 0.1mg/mL
BNC742218-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccl20 (NM_016960) Mouse Tagged ORF Clone
MG200285 10 µg

Ccl20 (NM_016960) Mouse Tagged ORF Clone

Sign In for Pricing
View Details