Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63A Rabbit Polyclonal Antibody (FITC)

TMEM63A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HLD19, KIAA0792

UniProt

O94886

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_055513

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS633329 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
TSTD1 (NM_001113205) Human Over-expression Lysate
LY426391 100 µg

TSTD1 (NM_001113205) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha-Bungarotoxin, CF®405S, 500 ug
#00002 1x 500 µg

Alpha-Bungarotoxin, CF®405S, 500 ug

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS708198 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702457 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human LYNX1-SLURP2 activation kit by CRISPRa
GA119997 1 Kit

Human LYNX1-SLURP2 activation kit by CRISPRa

Sign In for Pricing
View Details