Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0427 Rabbit Polyclonal Antibody (HRP)

KIAA0427 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm672, KIAA0427

UniProt

O43310

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0427

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055587

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prochlorococcus marinus DNA mismatch repair protein MutS (mutS), partial
MBS1147806 Inquire

Recombinant Prochlorococcus marinus DNA mismatch repair protein MutS (mutS), partial

Sign In for Pricing
View Details
SPA17P1 3'UTR GFP Stable Cell Line
TU074367 1.0 mL

SPA17P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ppm1a sgRNA CRISPR Lentivector set (Mouse)
K4844101 3x 1.0 µg

Ppm1a sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
4- (tert-Butylsulfanyl) -3-fluoroaniline
PRB33562-01 50 mg

4- (tert-Butylsulfanyl) -3-fluoroaniline

Sign In for Pricing
View Details
4- (tert-Butylsulfanyl) -3-fluoroaniline
PRB33562-02 0.5 g

4- (tert-Butylsulfanyl) -3-fluoroaniline

Sign In for Pricing
View Details
Human Ras-related protein Rab-20 (RAB20) ELISA Kit
abx541094 96 Tests

Human Ras-related protein Rab-20 (RAB20) ELISA Kit

Sign In for Pricing
View Details