Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scaf8 Rabbit Polyclonal Antibody (HRP)

Scaf8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rbm1, Rbm16, AA408306, AI447644, AI448652, AU015035, mKIAA1116, A630086M08Rik, A930036P18Rik

UniProt

Q6DID3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAPAVPAVSLVPPAFPVSMPVPPPGFNPIPPPPFLRASFNPSQPPPGFMP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

139kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598884

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC681989 CRISPRa sgRNA lentivector (set of three targets)(Rat)
27377126 3x 1.0µg DNA

LOC681989 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Map3k12 Knockout RAW 264.7 Polyclonal Cells
ARG12500 1 Million

Map3k12 Knockout RAW 264.7 Polyclonal Cells

Sign In for Pricing
View Details
Mmu-miR-365-2-5p miRNA Inhibitor
CIM0932-01 10 nmol

Mmu-miR-365-2-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-365-2-5p miRNA Inhibitor
CIM0932-02 20 nmol

Mmu-miR-365-2-5p miRNA Inhibitor

Sign In for Pricing
View Details
CMPK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV655418 1.0 µg DNA

CMPK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Mouse OLFR480 Protein, His (Fc)-Avi-tagged
OLFR480-6363M 50 µg

Recombinant Mouse OLFR480 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details