Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC7 Rabbit Polyclonal Antibody (FITC)

EXOSC7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P8, EAP1, RRP42, Rrp42p, hRrp42p

UniProt

Q15024

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_055819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF alpha/TGFA Rabbit Polyclonal Antibody (HRP)
orb2579292 100 µg

TGF alpha/TGFA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Adcy7 shRNA (UAS) - Lentiviral mouse Adcy7 shRNA (UAS) (100)
GTR15110262 1 Vial

Lentiviral mouse Adcy7 shRNA (UAS) - Lentiviral mouse Adcy7 shRNA (UAS) (100)

Sign In for Pricing
View Details
PARP1 Knockout HEK293 Polyclonal Cells
ARG12694 1 Million

PARP1 Knockout HEK293 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)
MBS1107585-01 0.02 mg (E-Coli)

Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)

Sign In for Pricing
View Details
Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)
MBS1107585-02 0.02 mg (Yeast)

Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)

Sign In for Pricing
View Details
Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)
MBS1107585-03 0.1 mg (E-Coli)

Recombinant Mouse Dual specificity protein kinase CLK2 (Clk2)

Sign In for Pricing
View Details