Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fnbp1 Rabbit Polyclonal Antibody (Biotin)

Fnbp1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FBP, FBP1, Fbp17, 1110057E06Rik, 2210010H06Rik

UniProt

Q80TY0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ENMTSQITVDLMRYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOSPD3 (NM_001040097) Human Over-expression Lysate
LC421670 20 µg

MOSPD3 (NM_001040097) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS636639 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
IRX2 Polyclonal Antibody
E-AB-18130-01 20 µL

IRX2 Polyclonal Antibody

Sign In for Pricing
View Details