Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fnbp1 Rabbit Polyclonal Antibody (HRP)

Fnbp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBP, FBP1, Fbp17, 1110057E06Rik, 2210010H06Rik

UniProt

Q80TY0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENMTSQITVDLMRYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRSV N Polyclonal Antibody
bs-41387R 100 µL

PRRSV N Polyclonal Antibody

Sign In for Pricing
View Details
PLAC1 CRISPR Activation Plasmid (m2)
sc-425008-ACT-2 20 µg

PLAC1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PURA Rabbit Polyclonal Antibody (HRP)
orb2128634 100 µL

PURA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Sema3b shRNA (UAS) - Lentiviral mouse Sema3b shRNA (UAS, GFP) (100)
GTR15239241 1 Vial

Lentiviral mouse Sema3b shRNA (UAS) - Lentiviral mouse Sema3b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Achatin-1 (Achatina fulica)
047-03 1 mg

Achatin-1 (Achatina fulica)

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (B-N36) [Alexa Fluor 488]
NBP3-14599AF488 0.1 mL

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (B-N36) [Alexa Fluor 488]

Sign In for Pricing
View Details