Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Larp4b Rabbit Polyclonal Antibody (FITC)

Larp4b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, Larp5, AI256361, D13Wsu64, D13Wsu64e, A630096F19

UniProt

Q6A0A2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Larp4b

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated H.pylori flagellin A
DAGA-063-B 1 mg

Biotinylated H.pylori flagellin A

Sign In for Pricing
View Details
Human anti-Encephalitis Virus PV (EP-Ab) Elisa Kit
EK700214 96 Well

Human anti-Encephalitis Virus PV (EP-Ab) Elisa Kit

Sign In for Pricing
View Details
PHBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV740185 1.0 µg DNA

PHBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human REN protein, C-His tag
IMP-1229 10 µg

Recombinant Human REN protein, C-His tag

Sign In for Pricing
View Details
Lentiviral human SHC1 sgRNA gene knockout kit - Lentiviral human SHC1 sgRNA gene knockout kit (plasmid)
GTR15363782 1 Vial

Lentiviral human SHC1 sgRNA gene knockout kit - Lentiviral human SHC1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human FGF17 protein
orb594739-01 10 µg

Human FGF17 protein

Sign In for Pricing
View Details