Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Larp4b Rabbit Polyclonal Antibody (HRP)

Larp4b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L, Larp5, AI256361, D13Wsu64, D13Wsu64e, A630096F19

UniProt

Q6A0A2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Larp4b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP40 Human Gene Knockout Kit (CRISPR)
KN419120 1 Kit

USP40 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM190A (CCSER1) (NM_207491) Human Over-expression Lysate
LY404048 100 µg

FAM190A (CCSER1) (NM_207491) Human Over-expression Lysate

Sign In for Pricing
View Details
ZCWPW2 Human Gene Knockout Kit (CRISPR)
KN420757 1 Kit

ZCWPW2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prss41 Mouse Gene Knockout Kit (CRISPR)
KN514042 1 Kit

Prss41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphononitrilic Chloride Trimer
TRC-P353750-25G 25 g

Phosphononitrilic Chloride Trimer

Sign In for Pricing
View Details
Recombinant Human Frizzled-10/FZD10 Protein (His Tag)
PKSH030507 100 µg

Recombinant Human Frizzled-10/FZD10 Protein (His Tag)

Sign In for Pricing
View Details