Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC3 Rabbit Polyclonal Antibody (HRP)

EXOSC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P10, PCH1B, RRP40, Rrp40p, CGI-102, hRrp-40, bA3J10.7

UniProt

Q9NQT5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody
orb2327948-01 25 µL

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody

Sign In for Pricing
View Details
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody
orb2327948-02 100 µL

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS) (100)
GTR15158226 1 Vial

Lentiviral mouse Rmi1 shRNA (UAS) - Lentiviral mouse Rmi1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Cyanine5 NHS ester iodide
T78405 2 mg

Cyanine5 NHS ester iodide

Sign In for Pricing
View Details
SOX17 Rabbit Polyclonal Antibody (Biotin)
orb2127211 100 µL

SOX17 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Sacm1l shRNA (UAS) - Lentiviral mouse Sacm1l shRNA (UAS, GFP) plasmid
GTR15244894 1 Vial

Lentiviral mouse Sacm1l shRNA (UAS) - Lentiviral mouse Sacm1l shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details