Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC3 Rabbit Polyclonal Antibody (HRP)

EXOSC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P10, PCH1B, RRP40, Rrp40p, CGI-102, hRrp-40, bA3J10.7

UniProt

Q9NQT5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EXOSC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR93 (A-5) Alexa Fluor® 790
sc-393763 AF790 200 µg/mL

WDR93 (A-5) Alexa Fluor® 790

Sign In for Pricing
View Details
ColorTag pipette marking rings, for all Eppendorf 12- or 24-channel pipette lower parts and Move It adjustable tip spacing pipettes, neon yellow, inner diameter: 73 mm, 5 pcs.
4031-6662 5 Pieces

ColorTag pipette marking rings, for all Eppendorf 12- or 24-channel pipette lower parts and Move It adjustable tip spacing pipettes, neon yellow, inner diameter: 73 mm, 5 pcs.

Sign In for Pricing
View Details
Slc7a3 Mouse qPCR Primer Pair (NM_007515)
MP215944 200 Reactions

Slc7a3 Mouse qPCR Primer Pair (NM_007515)

Sign In for Pricing
View Details
KIF1B CRISPR Knock Out 293T Cell Line (Human)
25667141 1x 10^6 Cells / 1.0 mL

KIF1B CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
PRR5L Protein Vector (Rat) (pPB-N-His)
PV296527 500 ng

PRR5L Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Melittin 50mg
A13912-50 50 mg

Melittin 50mg

Sign In for Pricing
View Details