Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC3 Rabbit Polyclonal Antibody (HRP)

EXOSC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P10, PCH1B, RRP40, Rrp40p, CGI-102, hRrp-40, bA3J10.7

UniProt

Q9NQT5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EXOSC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (AP)
MBS6348253-01 0.2 mL

SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (AP)

Sign In for Pricing
View Details
SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (AP)
MBS6348253-02 5x 0.2 mL

SLC25A31, ID (SLC25A31, AAC4, ANT4, SFEC, ADP/ATP translocase 4, ADP,ATP carrier protein 4, Adenine nucleotide translocator 4, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein) (AP)

Sign In for Pricing
View Details
3- (4-Chlorophenyl) glutaric Acid-d4
006542 5 mg

3- (4-Chlorophenyl) glutaric Acid-d4

Sign In for Pricing
View Details
MERTK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV661111 1.0 µg DNA

MERTK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Gm525 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22085124 3x 1.0µg DNA

Gm525 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
DNA Ligase IV Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-1677R-BF488 100 µL

DNA Ligase IV Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details