Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B6 Rabbit Polyclonal Antibody (FITC)

SF3B6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P14, Ht006, SAP14, SAP14a, SF3B14, CGI-110, HSPC175, SF3B14a

UniProt

Q9Y3B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B14

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]
TA802873BM 100 µL

FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details
Trfp (BC060122) Mouse Tagged ORF Clone
MG200965 10 µg

Trfp (BC060122) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL
BNCB2466-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JUNB Rabbit Polyclonal Antibody
AP02568PU-S 50 µL

JUNB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA10 (Center) Rabbit Polyclonal Antibody
AP52837PU-N 400 µL

NDUFA10 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC36A1 activation kit by CRISPRa
GA116468 1 Kit

Human SLC36A1 activation kit by CRISPRa

Sign In for Pricing
View Details