Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B6 Rabbit Polyclonal Antibody (HRP)

SF3B6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P14, Ht006, SAP14, SAP14a, SF3B14, CGI-110, HSPC175, SF3B14a

UniProt

Q9Y3B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem126a (NM_025460) Mouse Tagged ORF Clone
MG201925 10 µg

Tmem126a (NM_025460) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EPM2AIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA501927BM 100 µL

EPM2AIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Mouse PD-L1, C-His, Flag Tag
HA210689-01 20 µg

Mouse PD-L1, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse PD-L1, C-His, Flag Tag
HA210689-02 50 µg

Mouse PD-L1, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse PD-L1, C-His, Flag Tag
HA210689-03 100 µg

Mouse PD-L1, C-His, Flag Tag

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-1109
BMET-1109 1 Unit

Multi-parameter Analyzer BMET-1109

Sign In for Pricing
View Details