Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B6 Rabbit Polyclonal Antibody (Biotin)

SF3B6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P14, Ht006, SAP14, SAP14a, SF3B14, CGI-110, HSPC175, SF3B14a

UniProt

Q7RTV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SF3B14

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057131

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrfip1 CRISPR Activation Plasmid (m2)
sc-421470-ACT-2 20 µg

Lrrfip1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rnf166 3'UTR Luciferase Stable Cell Line
TU219527 1.0 mL

Rnf166 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Keratin, LMW (Low Molecular Weight Keratin, Type 1 Keratin, Type 1 Cytokeratin, Acidic Keratin, Acidic Cytokeratin, Epithelial Type 1 Keratin) (Biotin)
MBS6122299-01 0.1 mL

Keratin, LMW (Low Molecular Weight Keratin, Type 1 Keratin, Type 1 Cytokeratin, Acidic Keratin, Acidic Cytokeratin, Epithelial Type 1 Keratin) (Biotin)

Sign In for Pricing
View Details
Keratin, LMW (Low Molecular Weight Keratin, Type 1 Keratin, Type 1 Cytokeratin, Acidic Keratin, Acidic Cytokeratin, Epithelial Type 1 Keratin) (Biotin)
MBS6122299-02 5x 0.1 mL

Keratin, LMW (Low Molecular Weight Keratin, Type 1 Keratin, Type 1 Cytokeratin, Acidic Keratin, Acidic Cytokeratin, Epithelial Type 1 Keratin) (Biotin)

Sign In for Pricing
View Details
Recombinant Mouse Osteoglycin (OGN)
RPU43157-01 50 µg

Recombinant Mouse Osteoglycin (OGN)

Sign In for Pricing
View Details
Recombinant Mouse Osteoglycin (OGN)
RPU43157-02 100 µg

Recombinant Mouse Osteoglycin (OGN)

Sign In for Pricing
View Details