Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsd17b11 Rabbit Polyclonal Antibody (HRP)

Hsd17b11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pa, Dhr, SDR2, retS, Dhrs8, Pan1b, retSDR2

UniProt

Q9EQ06

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_444492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ALDH9A1 Antibody
NBP3-33496-20ul 20 µL

Rabbit Monoclonal ALDH9A1 Antibody

Sign In for Pricing
View Details
Glyceryl Tritridecanoate
B2018726 500 mg

Glyceryl Tritridecanoate

Sign In for Pricing
View Details
Connexin 32 (h) -PR
sc-43076-PR 10 µM - 20 µL

Connexin 32 (h) -PR

Sign In for Pricing
View Details
INTU Protein Vector (Human) (pPB-C-His)
PV053497 500 ng

INTU Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
GENLISA™ Human Pleiotrophin (PTN) ELISA
KBH0162 1x 96 Well

GENLISA™ Human Pleiotrophin (PTN) ELISA

Sign In for Pricing
View Details
Mouse Gm15412 activation kit by CRISPRa
GA218521 1 Kit

Mouse Gm15412 activation kit by CRISPRa

Sign In for Pricing
View Details