Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsd17b11 Rabbit Polyclonal Antibody (HRP)

Hsd17b11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pa, Dhr, SDR2, retS, Dhrs8, Pan1b, retSDR2

UniProt

Q9EQ06

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_444492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPRT Polyclonal Antibody
A61686-100 100 µL

UPRT Polyclonal Antibody

Sign In for Pricing
View Details
MRPS31 Rabbit mAb Antibody
orb1472711-01 50 μL

MRPS31 Rabbit mAb Antibody

Sign In for Pricing
View Details
MRPS31 Rabbit mAb Antibody
orb1472711-02 100 µL

MRPS31 Rabbit mAb Antibody

Sign In for Pricing
View Details
LAG3 Biosimilar Antibody
orb2670375-01 50 µg

LAG3 Biosimilar Antibody

Sign In for Pricing
View Details
LAG3 Biosimilar Antibody
orb2670375-02 100 µg

LAG3 Biosimilar Antibody

Sign In for Pricing
View Details
Human SNRNP27 Protein Lysate
MBS8419924-01 0.02 mg

Human SNRNP27 Protein Lysate

Sign In for Pricing
View Details