Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Evl Rabbit Polyclonal Antibody (Biotin)

Evl Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI528774, b2b2600C, b2b2600Clo

UniProt

Q6PB99

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Evl

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSNAMLFALNIMNSQEGGPSTQRQVQNGPSPEEMDIQRRQVMEQQHRQES

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC8 antibody
70R-21049 50 μL

TTC8 antibody

Sign In for Pricing
View Details
SAP97 Recombinant Antibody, Biotin Conjugated
bsm-62276R-Biotin 100 µL

SAP97 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (Biotin)
MBS6341985-01 0.2 mL

RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (Biotin)

Sign In for Pricing
View Details
RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (Biotin)
MBS6341985-02 5x 0.2 mL

RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (Biotin)

Sign In for Pricing
View Details
PRKCH Antibody
MBS7002145-01 0.05 mg

PRKCH Antibody

Sign In for Pricing
View Details
PRKCH Antibody
MBS7002145-02 0.1 mg

PRKCH Antibody

Sign In for Pricing
View Details