Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Evl Rabbit Polyclonal Antibody (HRP)

Evl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI528774, b2b2600C, b2b2600Clo

UniProt

Q6PB99

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Evl

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSNAMLFALNIMNSQEGGPSTQRQVQNGPSPEEMDIQRRQVMEQQHRQES

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1,1,2-tetrafluoro-2- (1,2,2,2-tetrafluoroethoxy) ethane
JH432361 1 Each

1,1,1,2-tetrafluoro-2- (1,2,2,2-tetrafluoroethoxy) ethane

Sign In for Pricing
View Details
GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma)
127657 100 µg

GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma)

Sign In for Pricing
View Details
Eco AluRack (HxD) 8x4=32 boxes, 32mm, 289x564x139mm, B10
TE11136B10 1 Piece

Eco AluRack (HxD) 8x4=32 boxes, 32mm, 289x564x139mm, B10

Sign In for Pricing
View Details
EZSolution™ SB 203580
1786-1 1 mg

EZSolution™ SB 203580

Sign In for Pricing
View Details
Anti-2019-nCoV S-cIgG1 Neutralizing Antibody
E-AB-V1023-01 50 µL

Anti-2019-nCoV S-cIgG1 Neutralizing Antibody

Sign In for Pricing
View Details
Anti-2019-nCoV S-cIgG1 Neutralizing Antibody
E-AB-V1023-02 100 µL

Anti-2019-nCoV S-cIgG1 Neutralizing Antibody

Sign In for Pricing
View Details