Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAS2 Rabbit Polyclonal Antibody (Biotin)

OAS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC78578

UniProt

P29728

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OAS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_058197

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase theta 1 (GSTT1) (NM_000853) Human Over-expression Lysate
E45H03092-2 20 µg

Glutathione S Transferase theta 1 (GSTT1) (NM_000853) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Smim17 shRNA (UAS) - Lentiviral mouse Smim17 shRNA (UAS, RFP) (100)
GTR15226284 1 Vial

Lentiviral mouse Smim17 shRNA (UAS) - Lentiviral mouse Smim17 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OR8D4, CT (OR8D4, Olfactory receptor 8D4, Olfactory receptor OR11-275) (Biotin) discontinued
039487-Biotin 200 µL

OR8D4, CT (OR8D4, Olfactory receptor 8D4, Olfactory receptor OR11-275) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit anti-Candida albicans (strain SC5314/MYA-2876)(Yeast) CBF1 Polyclonal Antibody
MBS9016909 Inquire

Rabbit anti-Candida albicans (strain SC5314/MYA-2876)(Yeast) CBF1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SLC37A2 sgRNA gene knockout kit - Lentiviral human SLC37A2 sgRNA gene knockout kit (100)
GTR15376357 1 Vial

Lentiviral human SLC37A2 sgRNA gene knockout kit - Lentiviral human SLC37A2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse Indoleamine 2,3-dioxygenase 1 ELISA Kit
MBS2885909-01 48 Well

Mouse Indoleamine 2,3-dioxygenase 1 ELISA Kit

Sign In for Pricing
View Details