Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAS2 Rabbit Polyclonal Antibody (Biotin)

OAS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC78578

UniProt

P29728

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OAS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_058197

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurotrophin-4 (NTF4) Antibody
abx173809 1 mL

Neurotrophin-4 (NTF4) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Girdin Antibody [Janelia Fluor 646]
NBP1-76253JF646 0.1 mL

Rabbit Polyclonal Girdin Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Pigeon Glucose Regulated Protein 78 ELISA Kit
MBS066859 Inquire

Pigeon Glucose Regulated Protein 78 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal RELM beta Antibody [DyLight 488]
NB200-204G 0.1 mL

Rabbit Polyclonal RELM beta Antibody [DyLight 488]

Sign In for Pricing
View Details
POU2F2 (OCT2, OTF2, POU Domain, Class 2, Transcription Factor 2, Lymphoid-restricted Immunoglobulin Octamer-binding Protein NF-A2, Octamer-binding Protein 2, Octamer-binding Transcription Factor 2) (FITC)
131623-FITC 100 µL

POU2F2 (OCT2, OTF2, POU Domain, Class 2, Transcription Factor 2, Lymphoid-restricted Immunoglobulin Octamer-binding Protein NF-A2, Octamer-binding Protein 2, Octamer-binding Transcription Factor 2) (FITC)

Sign In for Pricing
View Details
DECR1 (35-335, His-tag) Human Protein
AR09924PU-N 50 µg

DECR1 (35-335, His-tag) Human Protein

Sign In for Pricing
View Details