Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptogyrin-2 (SYNGR2), partial

Product Specifications

Product Name Alternative

Cellugyrin

Abbreviation

Recombinant Human SYNGR2 protein, partial

Gene Name

SYNGR2

UniProt

O43760

Expression Region

168-224aa

Organism

Homo sapiens (Human)

Target Sequence

QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone deacetylase 9 Rabbit Monoclonal Antibody [KD Validation]
E51K4238 40 µL

Histone deacetylase 9 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Adamtsl5 Mouse shRNA Plasmid (Locus ID 66548)
TL512036 1 Kit

Adamtsl5 Mouse shRNA Plasmid (Locus ID 66548)

Sign In for Pricing
View Details
ABHD14A Human shRNA Plasmid Kit (Locus ID 25864)
TR306907 1 Kit

ABHD14A Human shRNA Plasmid Kit (Locus ID 25864)

Sign In for Pricing
View Details
Recombinant Mouse IFITM10 Protein, His (Fc)-Avi-tagged
IFITM10-4435M 50 µg

Recombinant Mouse IFITM10 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Carbonic Anhydrase 12 Protein, Cynomolgus, Recombinant (His)
MF-0130890-01 5 µg

Carbonic Anhydrase 12 Protein, Cynomolgus, Recombinant (His)

Sign In for Pricing
View Details
Carbonic Anhydrase 12 Protein, Cynomolgus, Recombinant (His)
MF-0130890-02 10 µg

Carbonic Anhydrase 12 Protein, Cynomolgus, Recombinant (His)

Sign In for Pricing
View Details