Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOX1 Rabbit Polyclonal Antibody (Biotin)

ENOX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CNOX, PIG38, cCNOX, bA64J21.1

UniProt

Q8TC92

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ENOX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B9D2 Pre-designed siRNA Set B
SI001405B 1 Each

Human B9D2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
BTBD19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8401R-BF405-01 20 µL

BTBD19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
BTBD19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8401R-BF405-02 100 µL

BTBD19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
NPHS2 Rabbit Monoclonal Antibody
TA423599 100 µL

NPHS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human GSTA1 / Glutathione S-Transferase A1 Recombinant Protein
MBS2903553 Inquire

Human GSTA1 / Glutathione S-Transferase A1 Recombinant Protein

Sign In for Pricing
View Details
ZNF364 Antibody
25-828 100 µL

ZNF364 Antibody

Sign In for Pricing
View Details