Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOX1 Rabbit Polyclonal Antibody (HRP)

ENOX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CNOX, PIG38, cCNOX, bA64J21.1

UniProt

Q8TC92

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ENOX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIFL2 Antibody
orb794588 2 mg

ZIFL2 Antibody

Sign In for Pricing
View Details
Recombinant Panax ginseng NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC), partial
MBS7087057 Inquire

Recombinant Panax ginseng NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC), partial

Sign In for Pricing
View Details
TNXA Protein Vector (Human) (pPM-C-HA)
47271021 500 ng

TNXA Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RIIAD1 Protein Vector (Human) (pPM-C-HA)
PV115772 500 ng

RIIAD1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TRIM38 Antibody
E38PA4297 100 µL

TRIM38 Antibody

Sign In for Pricing
View Details
GRM2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61365R-BF750-01 20 µL

GRM2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details