Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM22 Rabbit Polyclonal Antibody (FITC)

RBM22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cwc2, ZC3H16, fSAP47

UniProt

Q9NW64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-01 24 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-02 48 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-03 96 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Cell Meter™ Fluorimetric Intracellular Total ROS Activity Assay Kit*Optimized for Flow Cytometry*
22904-AAT 100 Tests

Cell Meter™ Fluorimetric Intracellular Total ROS Activity Assay Kit*Optimized for Flow Cytometry*

Sign In for Pricing
View Details
ELOVL7 (C-term) Rabbit Polyclonal Antibody
AP51423PU-N 400 µL

ELOVL7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Urah Mouse Gene Knockout Kit (CRISPR)
KN518746 1 Kit

Urah Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details